PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013634795.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 272aa    MW: 31540 Da    PI: 5.2066
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013634795.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.6e-192168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv+ v  +G  +W+ Iar  g++Rt+k+c++rw++yl
   XP_013634795.1 21 KGPWTEEEDAILVNFVSIHGDARWNHIARSSGLKRTGKSCRLRWLNYL 68
                     79********************************************97 PP

2Myb_DNA-binding46.86.9e-1574117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE+  +++++ ++G++ W++Ia++++ gRt++++k++w++
   XP_013634795.1  74 RGNITLEEQFMILKLHSLWGNR-WSKIAQYLP-GRTDNEIKNYWRT 117
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.951672IPR017930Myb domain
SuperFamilySSF466891.09E-3018115IPR009057Homeodomain-like
SMARTSM007175.1E-162070IPR001005SANT/Myb domain
PfamPF002491.6E-162168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-222275IPR009057Homeodomain-like
CDDcd001672.98E-122368No hitNo description
PROSITE profilePS5129418.09873123IPR017930Myb domain
SMARTSM007171.1E-1373121IPR001005SANT/Myb domain
PfamPF002491.7E-1374117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2276122IPR009057Homeodomain-like
CDDcd001672.94E-1078117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MENYEQNLNS PAHEEDSDVR KGPWTEEEDA ILVNFVSIHG DARWNHIARS SGLKRTGKSC  60
RLRWLNYLRP DVRRGNITLE EQFMILKLHS LWGNRWSKIA QYLPGRTDNE IKNYWRTRVQ  120
KQAKHLRCDV NSNLFKETMK NVWMPRLMER INAQTPSPTY DPVESVITDP GQPIDKQTPV  180
EPGFVLNPDQ HRHQFVQASE LCATSSTSPA ETLSDVQDRV VNGSGYDPAG QTGFLELNDW  240
GCDDGDNMWT DDESFWFLRD QFCHETTSFS YN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-26181234108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ1441910.0KJ144191.1 Brassica rapa subsp. chinensis MYB transcription factor (MYB) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634795.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE15e-68MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D3C6P00.0A0A0D3C6P0_BRAOL; Uncharacterized protein
STRINGBra021389.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47190.11e-171myb domain protein 2